| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein ADP-ribosylation factor [52614] (16 species) |
| Species Human (Homo sapiens), ARF6 [TaxId:9606] [52617] (5 PDB entries) |
| Domain d2j5xb_: 2j5x B: [138073] automated match to d1e0sa_ complexed with gsp, mg |
PDB Entry: 2j5x (more details), 2.8 Å
SCOPe Domain Sequences for d2j5xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j5xb_ c.37.1.8 (B:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]}
nkemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggqdki
rplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdam
kpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyk
Timeline for d2j5xb_: