SCOPe 2.03: Domain d2j4za_: 2j4z A:

Lineage for d2j4za_ (2j4z A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (314 PDB entries)

8. Domain d2j4za_: 2j4z A: [138009]
   automated match to d1jksa_
   complexed with 626, ars

Details for d2j4za_

PDB Entry: 2j4z, 2 Å

PDB Description: structure of aurora-2 in complex with pha-680626

PDB Compounds: (A:) serine threonine-protein kinase 6

SCOPe Domain Sequences for d2j4za_:

Sequence; same for both SEQRES and ATOM records:

>d2j4za_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
ychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrm
hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk
hnpsqrpmlrevlehpwitanssk

Timeline for d2j4za_:

• d2j4za_ first appeared in SCOP 1.73, called d2j4za1
  
• d2j4za_ was called d2j4za1 in SCOPe 2.02
  
• d2j4za_ appears in SCOPe 2.04
  
• d2j4za_ appears in the current release, SCOPe 2.08