Lineage for d2j4za_ (2j4z A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. Protein automated matches [190417] (36 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1454 PDB entries)
  8. Domain d2j4za_: 2j4z A: [138009]
    automated match to d1jksa_
    complexed with 626, ars

Details for d2j4za_

PDB Entry: 2j4z (more details), 2 Å

PDB Description: structure of aurora-2 in complex with pha-680626
PDB Compounds: (A:) serine threonine-protein kinase 6

SCOPe Domain Sequences for d2j4za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j4za_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
ychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrm
hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk
hnpsqrpmlrevlehpwitanssk

SCOPe Domain Coordinates for d2j4za_ are not available.

Timeline for d2j4za_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2j4zb_