Lineage for d2j25a1 (2j25 A:1-77,A:432-497)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675781Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 675782Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 676142Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
    interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain
  6. 676199Protein Glucosylceramidase [89389] (1 species)
    glycosyl hydrolase family 30; the N-terminal extension wraps around the C-terminal core
  7. 676200Species Human (Homo sapiens) [TaxId:9606] [89390] (7 PDB entries)
  8. 676219Domain d2j25a1: 2j25 A:1-77,A:432-497 [137955]
    Other proteins in same PDB: d2j25a2, d2j25b2
    automatically matched to d1ogsa1
    complexed with bma, man, nag, so4

Details for d2j25a1

PDB Entry: 2j25 (more details), 2.9 Å

PDB Description: partially deglycosylated glucoceramidase
PDB Compounds: (A:) glucosylceramidase

SCOP Domain Sequences for d2j25a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j25a1 b.71.1.2 (A:1-77,A:432-497) Glucosylceramidase {Human (Homo sapiens) [TaxId: 9606]}
arpcipksfgyssvvcvcnatycdsfdpptfpalgtfsryestrsgrrmelsmgpiqanh
tgtgllltlqpeqkfqkXqrvglvasqkndldavalmhpdgsavvvvlnrsskdvpltik
dpavgfletispgysihtylwhrq

SCOP Domain Coordinates for d2j25a1:

Click to download the PDB-style file with coordinates for d2j25a1.
(The format of our PDB-style files is described here.)

Timeline for d2j25a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j25a2