SCOP 1.73: Domain d2j25a2: 2j25 A:78-431

Lineage for d2j25a2 (2j25 A:78-431)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.3: beta-glycanases [51487] (24 proteins)
   consist of a number of sequence families

6. Protein Glucosylceramidase, catalytic domain [89473] (1 species)
   acid-beta-glucosidase; glycosyl hydrolase family 30; contains additional beta-domain similar to one found in alpha amylases

7. Species Human (Homo sapiens) [TaxId:9606] [89474] (7 PDB entries)

8. Domain d2j25a2: 2j25 A:78-431 [137956]
   Other proteins in same PDB: d2j25a1, d2j25b1
   automatically matched to d1ogsa2
   complexed with bma, man, nag, so4

Details for d2j25a2

PDB Entry: 2j25, 2.9 Å

PDB Description: partially deglycosylated glucoceramidase

PDB Compounds: (A:) glucosylceramidase

SCOP Domain Sequences for d2j25a2:

Sequence; same for both SEQRES and ATOM records:

>d2j25a2 c.1.8.3 (A:78-431) Glucosylceramidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
vkgfggamtdaaalnilalsppaqnlllksyfseegigyniirvpmascdfsirtytyad
tpddfqlhnfslpeedtklkiplihralqlaqrpvsllaspwtsptwlktngavngkgsl
kgqpgdiyhqtwaryfvkfldayaehklqfwavtaenepsagllsgypfqclgftpehqr
dfiardlgptlansthhnvrllmlddqrlllphwakvvltdpeaakyvhgiavhwyldfl
apakatlgethrlfpntmlfaseacvgskfweqsvrlgswdrgmqyshsiitnllyhvvg
wtdwnlalnpeggpnwvrnfvdspiivditkdtfykqpmfyhlghfskfipegs

Timeline for d2j25a2:

• d2j25a2 is new in SCOP 1.73
  
• d2j25a2 appears in SCOP 1.75
  
• d2j25a2 appears in the current release, SCOPe 2.08