Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48731] (8 PDB entries) |
Domain d2j12b1: 2j12 B:21-138 [137933] Other proteins in same PDB: d2j12a1 automatically matched to d1rsfa_ complexed with ca |
PDB Entry: 2j12 (more details), 1.5 Å
SCOP Domain Sequences for d2j12b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j12b1 b.1.1.1 (B:21-138) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} sittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiy ddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvl
Timeline for d2j12b1: