Lineage for d2j12b_ (2j12 B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (24 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) 
Domain d2j12b_: 2j12 B: [137933]
Other proteins in same PDB: d2j12a_
automated match to d1eaja_
complexed with ca
Details for d2j12b_
PDB Entry: 2j12 (more details), 1.5 Å
PDB Description: ad37 fibre head in complex with car d1
PDB Compounds: (B:) coxsackievirus and adenovirus receptorSCOPe Domain Sequences for d2j12b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j12b_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdk
iyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvl
SCOPe Domain Coordinates for d2j12b_:
Click to download the PDB-style file with coordinates for d2j12b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2j12b_:
- d2j12b_ first appeared in SCOP 1.73, called d2j12b1
- d2j12b_ appears in SCOPe 2.07
View in 3D
