SCOP 1.75: Domain d2j0xb1: 2j0x B:3-294

Lineage for d2j0xb1 (2j0x B:3-294)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (3 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.3: PyrH-like [142721] (3 proteins)
   part of Pfam PF00696

6. Protein Aspartokinase [142724] (3 species)

7. Species Escherichia coli [TaxId:562] [142727] (2 PDB entries)
   Uniprot P08660 3-294
   Lysine-sensitive aspartokinase 3

8. Domain d2j0xb1: 2j0x B:3-294 [137929]
   Other proteins in same PDB: d2j0xa2, d2j0xa3, d2j0xb2, d2j0xb3
   automatically matched to 2J0W A:3-294
   complexed with asp, lys, po4

Details for d2j0xb1

PDB Entry: 2j0x, 2.8 Å

PDB Description: crystal structure of e. coli aspartokinase iii in complex with lysine and aspartate (t-state)

PDB Compounds: (B:) lysine-sensitive aspartokinase 3

SCOP Domain Sequences for d2j0xb1:

Sequence; same for both SEQRES and ATOM records:

>d2j0xb1 c.73.1.3 (B:3-294) Aspartokinase {Escherichia coli [TaxId: 562]}
eivvskfggtsvadfdamnrsadivlsdanvrlvvlsasagitnllvalaeglepgerfe
kldairniqfailerlrypnvireeierllenitvlaeaaalatspaltdelvshgelms
tllfveilrerdvqaqwfdvrkvmrtndrfgraepdiaalaelaalqllprlneglvitq
gfigsenkgrtttlgrggsdytaallaealhasrvdiwtdvpgiyttdprvvsaakride
iafaeaaematfgakvlhpatllpavrsdipvfvgsskdpraggtlvcnkte

Timeline for d2j0xb1:

• d2j0xb1 first appeared in SCOP 1.73
  
• d2j0xb1 appears in SCOPe 2.01
  
• d2j0xb1 appears in the current release, SCOPe 2.08