Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (3 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.3: PyrH-like [142721] (3 proteins) part of Pfam PF00696 |
Protein Aspartokinase [142724] (3 species) |
Species Escherichia coli [TaxId:562] [142727] (2 PDB entries) Uniprot P08660 3-294 Lysine-sensitive aspartokinase 3 |
Domain d2j0xb1: 2j0x B:3-294 [137929] Other proteins in same PDB: d2j0xa2, d2j0xa3, d2j0xb2, d2j0xb3 automatically matched to 2J0W A:3-294 complexed with asp, lys, po4 |
PDB Entry: 2j0x (more details), 2.8 Å
SCOP Domain Sequences for d2j0xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0xb1 c.73.1.3 (B:3-294) Aspartokinase {Escherichia coli [TaxId: 562]} eivvskfggtsvadfdamnrsadivlsdanvrlvvlsasagitnllvalaeglepgerfe kldairniqfailerlrypnvireeierllenitvlaeaaalatspaltdelvshgelms tllfveilrerdvqaqwfdvrkvmrtndrfgraepdiaalaelaalqllprlneglvitq gfigsenkgrtttlgrggsdytaallaealhasrvdiwtdvpgiyttdprvvsaakride iafaeaaematfgakvlhpatllpavrsdipvfvgsskdpraggtlvcnkte
Timeline for d2j0xb1: