Lineage for d2j0na1 (2j0n A:144-314)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738288Fold a.250: IpaD-like [140692] (1 superfamily)
    6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest
  4. 2738289Superfamily a.250.1: IpaD-like [140693] (2 families) (S)
  5. 2738290Family a.250.1.1: IpaD-like [140694] (3 proteins)
    Pfam PF06511
  6. 2738291Protein Invasin IpaD [140695] (1 species)
  7. 2738292Species Shigella flexneri [TaxId:623] [140696] (3 PDB entries)
    Uniprot P18013 128-320! Uniprot P18013 144-314! Uniprot P18013 39-322
  8. 2738294Domain d2j0na1: 2j0n A:144-314 [137899]
    truncated, lacks two N-terminal helices

Details for d2j0na1

PDB Entry: 2j0n (more details), 2.1 Å

PDB Description: a proteolytically truncated form of shigella flexneri ipad
PDB Compounds: (A:) invasin ipad

SCOPe Domain Sequences for d2j0na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0na1 a.250.1.1 (A:144-314) Invasin IpaD {Shigella flexneri [TaxId: 623]}
dineqylkvyehavssytqmyqdfsavlsslagwispggndgnsvklqvnslkkaleelk
ekykdkplypanntvsqeqankwltelggtigkvsqknggyvvsinmtpidnmlksldnl
ggngevvldnakyqawnagfsaedetmknnlqtlvqkysnansifdnlvkv

SCOPe Domain Coordinates for d2j0na1:

Click to download the PDB-style file with coordinates for d2j0na1.
(The format of our PDB-style files is described here.)

Timeline for d2j0na1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2j0nb_