| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (7 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (38 proteins) Pfam PF00240 |
| Protein Elongin B [54246] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54247] (5 PDB entries) |
| Domain d2izvb1: 2izv B:1-105 [137828] Other proteins in same PDB: d2izvc1 automatically matched to d1lm8b_ complexed with cl, edo, na |
PDB Entry: 2izv (more details), 2.55 Å
SCOP Domain Sequences for d2izvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2izvb1 d.15.1.1 (B:1-105) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvmkp
Timeline for d2izvb1: