Class a: All alpha proteins [46456] (290 folds) |
Fold a.250: IpaD-like [140692] (1 superfamily) 6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest |
Superfamily a.250.1: IpaD-like [140693] (2 families) |
Family a.250.1.1: IpaD-like [140694] (3 proteins) Pfam PF06511 |
Protein Putative membrane antigen BipD [140697] (1 species) |
Species Burkholderia pseudomallei [TaxId:28450] [140698] (5 PDB entries) Uniprot Q63K37 35-301 |
Domain d2izpa_: 2izp A: [137826] automated match to d2j9ta1 |
PDB Entry: 2izp (more details), 2.1 Å
SCOPe Domain Sequences for d2izpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2izpa_ a.250.1.1 (A:) Putative membrane antigen BipD {Burkholderia pseudomallei [TaxId: 28450]} agaramtdddlraagvdrrvpeqklgaaidefaslrlpdridgrfvdgrranltvfddar vavrgharaqrnllerletellggtldtagdeggiqpdpilqglvdvigqgksdidayat ivegltkyfqsvadvmsklqdyisakddknmkidggkikaliqqvidhlptmqlpkgadi arwrkelgdavsisdsgvvtinpdklikmrdslppdgtvwdtaryqawntafsgqkdniq ndvqtlvekyshqnsnfdnlvkvlsgaistlt
Timeline for d2izpa_: