Lineage for d2iz8a1 (2iz8 A:1-129)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203937Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 2203938Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 2203939Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 2203988Protein MS2 virus coat protein [55407] (1 species)
  7. 2203989Species Bacteriophage MS2 [TaxId:12022] [55408] (36 PDB entries)
    Uniprot P03612
  8. 2204089Domain d2iz8a1: 2iz8 A:1-129 [137817]
    automatically matched to d1dzsa_
    protein/RNA complex

Details for d2iz8a1

PDB Entry: 2iz8 (more details), 3.3 Å

PDB Description: ms2-rna hairpin (c-7) complex
PDB Compounds: (A:) ms2 coat protein

SCOPe Domain Sequences for d2iz8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iz8a1 d.85.1.1 (A:1-129) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOPe Domain Coordinates for d2iz8a1:

Click to download the PDB-style file with coordinates for d2iz8a1.
(The format of our PDB-style files is described here.)

Timeline for d2iz8a1: