Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins) similar to the nucleotide/nucleoside kinases but acts on different substrate |
Protein automated matches [190331] (1 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [187153] (10 PDB entries) |
Domain d2iyva_: 2iyv A: [137812] automated match to d1l4ua_ complexed with adp, cl |
PDB Entry: 2iyv (more details), 1.35 Å
SCOPe Domain Sequences for d2iyva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iyva_ c.37.1.2 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvpspseaatlehh
Timeline for d2iyva_: