Lineage for d2iyva_ (2iyv A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163404Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins)
    similar to the nucleotide/nucleoside kinases but acts on different substrate
  6. 1163434Protein automated matches [190331] (1 species)
    not a true protein
  7. 1163435Species Mycobacterium tuberculosis [TaxId:83332] [187153] (10 PDB entries)
  8. 1163436Domain d2iyva_: 2iyv A: [137812]
    automated match to d1l4ua_
    complexed with adp, cl

Details for d2iyva_

PDB Entry: 2iyv (more details), 1.35 Å

PDB Description: shikimate kinase from mycobacterium tuberculosis in complex with adp, open lid (conf. b)
PDB Compounds: (A:) Shikimate kinase

SCOPe Domain Sequences for d2iyva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iyva_ c.37.1.2 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvpspseaatlehh

SCOPe Domain Coordinates for d2iyva_:

Click to download the PDB-style file with coordinates for d2iyva_.
(The format of our PDB-style files is described here.)

Timeline for d2iyva_: