SCOPe 2.03: Domain d2iyld2: 2iyl D:97-303

Lineage for d2iyld2 (2iyl D:97-303)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein GTPase domain of the signal recognition particle receptor FtsY [52666] (3 species)

7. Species Thermus aquaticus [TaxId:271] [102374] (5 PDB entries)

8. Domain d2iyld2: 2iyl D:97-303 [137802]
   Other proteins in same PDB: d2iyld1
   automatically matched to d1okkd2
   protein/RNA complex; complexed with gdp, so4

Details for d2iyld2

PDB Entry: 2iyl, 2.1 Å

PDB Description: structure of an ftsy:gdp complex

PDB Compounds: (D:) cell division protein ftsy

SCOPe Domain Sequences for d2iyld2:

Sequence, based on SEQRES records:

>d2iyld2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}
pvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdtfraaggtqlsewgkrl
sipviqgpegtdpaalaydavqamkargydllfvdtagrlhtkhnlmeelkkvkraiaka
dpeepkevwlvldavtgqngleqakkfheavgltgvivtkldgtakggvlipivrtlkvp
ikfvgvgegpddlqpfdpeafvealle

Sequence, based on observed residues (ATOM records):

>d2iyld2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}
pvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdttqlsewgkrlsipviq
gpegtdpaalaydavqamkargydllfvdtagrlhtkhnlmeelkkvkraiakadpeepk
evwlvldavtgqleqakkfheavgltgvivtkldgtakggvlipivrtlkvpikfvgvge
gpddlqpfdpeafvealle

Timeline for d2iyld2:

• d2iyld2 first appeared in SCOP 1.73
  
• d2iyld2 appears in SCOPe 2.02
  
• d2iyld2 appears in SCOPe 2.04
  
• d2iyld2 appears in the current release, SCOPe 2.08