Lineage for d2iyld2 (2iyl D:91-304)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869013Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2869314Protein automated matches [190304] (16 species)
    not a true protein
  7. 2869413Species Thermus aquaticus [TaxId:271] [255076] (4 PDB entries)
  8. 2869420Domain d2iyld2: 2iyl D:91-304 [137802]
    Other proteins in same PDB: d2iyld1
    automated match to d2cnwd2
    protein/RNA complex; complexed with gdp, so4

Details for d2iyld2

PDB Entry: 2iyl (more details), 2.1 Å

PDB Description: structure of an ftsy:gdp complex
PDB Compounds: (D:) cell division protein ftsy

SCOPe Domain Sequences for d2iyld2:

Sequence, based on SEQRES records: (download)

>d2iyld2 c.37.1.10 (D:91-304) automated matches {Thermus aquaticus [TaxId: 271]}
npqkpkpvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdtfraaggtqls
ewgkrlsipviqgpegtdpaalaydavqamkargydllfvdtagrlhtkhnlmeelkkvk
raiakadpeepkevwlvldavtgqngleqakkfheavgltgvivtkldgtakggvlipiv
rtlkvpikfvgvgegpddlqpfdpeafvealled

Sequence, based on observed residues (ATOM records): (download)

>d2iyld2 c.37.1.10 (D:91-304) automated matches {Thermus aquaticus [TaxId: 271]}
npqkpvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdttqlsewgkrlsi
pviqgpegtdpaalaydavqamkargydllfvdtagrlhtkhnlmeelkkvkraiakadp
eepkevwlvldavtgqleqakkfheavgltgvivtkldgtakggvlipivrtlkvpikfv
gvgegpddlqpfdpeafvealled

SCOPe Domain Coordinates for d2iyld2:

Click to download the PDB-style file with coordinates for d2iyld2.
(The format of our PDB-style files is described here.)

Timeline for d2iyld2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iyld1