| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein Cyclin A [47956] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47957] (74 PDB entries) Uniprot P20248 175-432 |
| Domain d2iw6d2: 2iw6 D:310-432 [137743] Other proteins in same PDB: d2iw6a1, d2iw6c_ automated match to d1oiub2 complexed with mg, qq2, sgm |
PDB Entry: 2iw6 (more details), 2.3 Å
SCOPe Domain Sequences for d2iw6d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iw6d2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl
Timeline for d2iw6d2:
View in 3DDomains from other chains: (mouse over for more information) d2iw6a1, d2iw6b1, d2iw6b2, d2iw6c_ |