| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (3 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (4 proteins) |
| Protein Cyclin A [47956] (2 species) |
| Species Cow (Bos taurus) [TaxId:9913] [47958] (19 PDB entries) |
| Domain d2iw6b1: 2iw6 B:181-308 [137740] automatically matched to d1vin_1 complexed with mg, qq2, sgm; mutant |
PDB Entry: 2iw6 (more details), 2.3 Å
SCOP Domain Sequences for d2iw6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iw6b1 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vltfdlaa
Timeline for d2iw6b1: