Lineage for d2iw6d1 (2iw6 D:181-308)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644042Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 644043Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 644044Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 644055Protein Cyclin A [47956] (2 species)
  7. 644056Species Cow (Bos taurus) [TaxId:9913] [47958] (19 PDB entries)
  8. 644097Domain d2iw6d1: 2iw6 D:181-308 [137742]
    automatically matched to d1vin_1
    complexed with mg, qq2, sgm; mutant

Details for d2iw6d1

PDB Entry: 2iw6 (more details), 2.3 Å

PDB Description: structure of human thr160-phospho cdk2-cyclin a complexed with a bisanilinopyrimidine inhibitor
PDB Compounds: (D:) Cyclin-A2

SCOP Domain Sequences for d2iw6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iw6d1 a.74.1.1 (D:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vltfdlaa

SCOP Domain Coordinates for d2iw6d1:

Click to download the PDB-style file with coordinates for d2iw6d1.
(The format of our PDB-style files is described here.)

Timeline for d2iw6d1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iw6d2