Lineage for d2iuzb1 (2iuz B:39-298,B:361-433)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1340705Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 1340706Protein Chitinase 1 [51548] (2 species)
  7. 1340707Species Aspergillus fumigatus [TaxId:5085] [117368] (14 PDB entries)
    Uniprot Q873X9
  8. 1340721Domain d2iuzb1: 2iuz B:39-298,B:361-433 [137712]
    Other proteins in same PDB: d2iuza2, d2iuzb2
    automated match to d1w9pa1
    complexed with d1h, so4

Details for d2iuzb1

PDB Entry: 2iuz (more details), 1.95 Å

PDB Description: crystal structure of aspergillus fumigatus chitinase b1 in complex with c2-dicaffeine
PDB Compounds: (B:) chitinase

SCOPe Domain Sequences for d2iuzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iuzb1 c.1.8.5 (B:39-298,B:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]}
assgyrsvvyfvnwaiygrnhnpqdlpverlthvlyafanvrpetgevymtdswadiekh
ypgdswsdtgnnvygcikqlyllkkqnrnlkvllsiggwtyspnfapaastdagrknfak
tavkllqdlgfdgldidweypendqqandfvlllkevrtaldsysaanaggqhflltvas
pagpdkikvlhlkdmdqqldfwnlmaydyagsfsslsghqanvyndtsnplstpfntqta
ldlyraggvpankivlgmplXdnpqvanlksgyikslglggamwwdsssdktgsdslitt
vvnalggtgvfeqsqneldypvsqydnlrngmqt

SCOPe Domain Coordinates for d2iuzb1:

Click to download the PDB-style file with coordinates for d2iuzb1.
(The format of our PDB-style files is described here.)

Timeline for d2iuzb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iuzb2