Lineage for d1w9pa1 (1w9p A:39-298,A:361-433)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.5: Type II chitinase [51534] (15 proteins)
glycosylase family 18
Protein Chitinase 1 [51548] (2 species) Species Aspergillus fumigatus [TaxId:5085] [117368] (14 PDB entries)
Uniprot Q873X9
Domain d1w9pa1: 1w9p A:39-298,A:361-433 [114412]
Other proteins in same PDB: d1w9pa2, d1w9pb2
complexed with so4
Details for d1w9pa1
PDB Entry: 1w9p (more details), 1.7 Å
PDB Description: specificity and affinity of natural product cyclopentapeptide inhibitors against aspergillus fumigatus, human and bacterial chitinasefra
PDB Compounds: (A:) chitinaseSCOPe Domain Sequences for d1w9pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]}
assgyrsvvyfvnwaiygrnhnpqdlpverlthvlyafanvrpetgevymtdswadiekh
ypgdswsdtgnnvygcikqlyllkkqnrnlkvllsiggwtyspnfapaastdagrknfak
tavkllqdlgfdgldidweypendqqandfvlllkevrtaldsysaanaggqhflltvas
pagpdkikvlhlkdmdqqldfwnlmaydyagsfsslsghqanvyndtsnplstpfntqta
ldlyraggvpankivlgmplXdnpqvanlksgyikslglggamwwdsssdktgsdslitt
vvnalggtgvfeqsqneldypvsqydnlrngmqt
SCOPe Domain Coordinates for d1w9pa1:
Click to download the PDB-style file with coordinates for d1w9pa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1w9pa1:
- d1w9pa1 first appeared in SCOP 1.71
- d1w9pa1 appears in SCOPe 2.02
- d1w9pa1 appears in SCOPe 2.04
- d1w9pa1 appears in the current release, SCOPe 2.08
View in 3D
