Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein Potassium channel protein [56901] (2 species) |
Species Streptomyces lividans [TaxId:1916] [161074] (17 PDB entries) |
Domain d2itcc1: 2itc C:22-124 [137638] automatically matched to d1k4cc_ complexed with na |
PDB Entry: 2itc (more details), 3.2 Å
SCOPe Domain Sequences for d2itcc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2itcc1 f.14.1.1 (C:22-124) Potassium channel protein {Streptomyces lividans [TaxId: 1916]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d2itcc1: