Lineage for d2itcc1 (2itc C:22-124)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745164Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 745165Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 745166Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins)
  6. 745181Protein Potassium channel protein [56901] (1 species)
  7. 745182Species Streptomyces coelicolor [TaxId:1902] [56902] (27 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
  8. 745202Domain d2itcc1: 2itc C:22-124 [137638]
    automatically matched to d1k4cc_
    complexed with na; mutant

Details for d2itcc1

PDB Entry: 2itc (more details), 3.2 Å

PDB Description: potassium channel kcsa-fab complex in sodium chloride
PDB Compounds: (C:) Voltage-gated potassium channel

SCOP Domain Sequences for d2itcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2itcc1 f.14.1.1 (C:22-124) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOP Domain Coordinates for d2itcc1:

Click to download the PDB-style file with coordinates for d2itcc1.
(The format of our PDB-style files is described here.)

Timeline for d2itcc1: