SCOP 1.73: Domain d2iqqb1: 2iqq B:14-158

Lineage for d2iqqb1 (2iqq B:14-158)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.2: Serine metabolism enzymes domain [143548] (2 families)
   contains extra C-terminal beta-hairpin

5. Family d.81.2.1: Serine dehydratase beta chain-like [143549] (1 protein)
   Pfam PF03315

6. Protein L-serine dehydratase SdhL, N-terminal domain [143550] (1 species)

7. Species Legionella pneumophila [TaxId:446] [143551] (2 PDB entries)

8. Domain d2iqqb1: 2iqq B:14-158 [137590]
   automatically matched to 2IQQ A:14-158
   complexed with mg

Details for d2iqqb1

PDB Entry: 2iqq, 2.66 Å

PDB Description: the crystal structure of iron, sulfur-dependent l-serine dehydratase from legionella pneumophila subsp. pneumophila

PDB Compounds: (B:) Iron, Sulfur-Dependent L-serine dehydratase

SCOP Domain Sequences for d2iqqb1:

Sequence; same for both SEQRES and ATOM records:

>d2iqqb1 d.81.2.1 (B:14-158) L-serine dehydratase SdhL, N-terminal domain {Legionella pneumophila [TaxId: 446]}
sshtvgpmlaanaflqlleqknlfdktqrvkvelygslaltgkghgtdkailnglenkap
etvdpasmiprmheildsnllnlagkkeipfheatdflflqkellpkhsngmrfsafdgn
anllieqvyysigggfitteedfdk

Timeline for d2iqqb1:

• d2iqqb1 is new in SCOP 1.73
  
• d2iqqb1 appears in SCOP 1.75
  
• d2iqqb1 appears in the current release, SCOPe 2.08, called d2iqqb_