Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.2: Serine metabolism enzymes domain [143548] (2 families) contains extra C-terminal beta-hairpin |
Family d.81.2.1: Serine dehydratase beta chain-like [143549] (1 protein) Pfam PF03315 |
Protein L-serine dehydratase SdhL, N-terminal domain [143550] (1 species) |
Species Legionella pneumophila [TaxId:446] [143551] (2 PDB entries) |
Domain d2iqqb1: 2iqq B:14-158 [137590] automatically matched to 2IQQ A:14-158 complexed with mg |
PDB Entry: 2iqq (more details), 2.66 Å
SCOP Domain Sequences for d2iqqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iqqb1 d.81.2.1 (B:14-158) L-serine dehydratase SdhL, N-terminal domain {Legionella pneumophila [TaxId: 446]} sshtvgpmlaanaflqlleqknlfdktqrvkvelygslaltgkghgtdkailnglenkap etvdpasmiprmheildsnllnlagkkeipfheatdflflqkellpkhsngmrfsafdgn anllieqvyysigggfitteedfdk
Timeline for d2iqqb1: