Lineage for d2iqqb_ (2iqq B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527131Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2527738Superfamily d.81.2: Serine metabolism enzymes domain [143548] (2 families) (S)
    contains extra C-terminal beta-hairpin
  5. 2527739Family d.81.2.1: Serine dehydratase beta chain-like [143549] (2 proteins)
    Pfam PF03315
  6. 2527744Protein automated matches [190719] (1 species)
    not a true protein
  7. 2527745Species Legionella pneumophila [TaxId:272624] [187872] (1 PDB entry)
  8. 2527746Domain d2iqqb_: 2iqq B: [137590]
    Other proteins in same PDB: d2iqqa1
    automated match to d2iafa1
    complexed with mg

Details for d2iqqb_

PDB Entry: 2iqq (more details), 2.66 Å

PDB Description: the crystal structure of iron, sulfur-dependent l-serine dehydratase from legionella pneumophila subsp. pneumophila
PDB Compounds: (B:) Iron, Sulfur-Dependent L-serine dehydratase

SCOPe Domain Sequences for d2iqqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iqqb_ d.81.2.1 (B:) automated matches {Legionella pneumophila [TaxId: 272624]}
sshtvgpmlaanaflqlleqknlfdktqrvkvelygslaltgkghgtdkailnglenkap
etvdpasmiprmheildsnllnlagkkeipfheatdflflqkellpkhsngmrfsafdgn
anllieqvyysigggfitteedfdk

SCOPe Domain Coordinates for d2iqqb_:

Click to download the PDB-style file with coordinates for d2iqqb_.
(The format of our PDB-style files is described here.)

Timeline for d2iqqb_: