SCOPe 2.08: Domain d2iqqb_: 2iqq B:

Lineage for d2iqqb_ (2iqq B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.2: Serine metabolism enzymes domain [143548] (2 families)
   contains extra C-terminal beta-hairpin

5. Family d.81.2.1: Serine dehydratase beta chain-like [143549] (2 proteins)
   Pfam PF03315

6. Protein automated matches [190719] (1 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:272624] [187872] (1 PDB entry)

8. Domain d2iqqb_: 2iqq B: [137590]
   Other proteins in same PDB: d2iqqa1
   automated match to d2iafa1
   complexed with mg

Details for d2iqqb_

PDB Entry: 2iqq, 2.66 Å

PDB Description: the crystal structure of iron, sulfur-dependent l-serine dehydratase from legionella pneumophila subsp. pneumophila

PDB Compounds: (B:) Iron, Sulfur-Dependent L-serine dehydratase

SCOPe Domain Sequences for d2iqqb_:

Sequence; same for both SEQRES and ATOM records:

>d2iqqb_ d.81.2.1 (B:) automated matches {Legionella pneumophila [TaxId: 272624]}
sshtvgpmlaanaflqlleqknlfdktqrvkvelygslaltgkghgtdkailnglenkap
etvdpasmiprmheildsnllnlagkkeipfheatdflflqkellpkhsngmrfsafdgn
anllieqvyysigggfitteedfdk

Timeline for d2iqqb_:

• d2iqqb_ first appeared in SCOP 1.73, called d2iqqb1
  
• d2iqqb_ appears in SCOPe 2.07