| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.2: Serine metabolism enzymes domain [143548] (2 families) ![]() contains extra C-terminal beta-hairpin |
| Family d.81.2.1: Serine dehydratase beta chain-like [143549] (2 proteins) Pfam PF03315 |
| Protein automated matches [190719] (1 species) not a true protein |
| Species Legionella pneumophila [TaxId:272624] [187872] (1 PDB entry) |
| Domain d2iqqb_: 2iqq B: [137590] Other proteins in same PDB: d2iqqa1 automated match to d2iafa1 complexed with mg |
PDB Entry: 2iqq (more details), 2.66 Å
SCOPe Domain Sequences for d2iqqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iqqb_ d.81.2.1 (B:) automated matches {Legionella pneumophila [TaxId: 272624]}
sshtvgpmlaanaflqlleqknlfdktqrvkvelygslaltgkghgtdkailnglenkap
etvdpasmiprmheildsnllnlagkkeipfheatdflflqkellpkhsngmrfsafdgn
anllieqvyysigggfitteedfdk
Timeline for d2iqqb_: