SCOPe 2.08: Domain d2io7b2: 2io7 B:12-200

Lineage for d2io7b2 (2io7 B:12-200)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.15: CHAP domain [142870] (1 protein)
   Pfam PF05257

6. Protein Glutathionylspermidine synthase, amidase domain [142871] (1 species)

7. Species Escherichia coli [TaxId:562] [142872] (5 PDB entries)
   Uniprot P0AES0 10-200

8. Domain d2io7b2: 2io7 B:12-200 [137547]
   Other proteins in same PDB: d2io7a1, d2io7a3, d2io7b1, d2io7b3
   automated match to d2io7a2
   complexed with anp, mg

Details for d2io7b2

PDB Entry: 2io7, 2.7 Å

PDB Description: E. coli Bifunctional glutathionylspermidine synthetase/amidase Incomplex with Mg2+ and AMPPNP

PDB Compounds: (B:) Bifunctional glutathionylspermidine synthetase/amidase

SCOPe Domain Sequences for d2io7b2:

Sequence, based on SEQRES records:

>d2io7b2 d.3.1.15 (B:12-200) Glutathionylspermidine synthase, amidase domain {Escherichia coli [TaxId: 562]}
fgtllgyapggvaiyssdyssldpqeyeddavfrsyiddeymghkwqcvefarrflflny
gvvftdvgmaweifslrflrevvndnilplqafpngsprapvagalliwdkggefkdtgh
vaiitqlhgnkvriaeqnvihsplpqgqqwtrelemvvengcytlkdtfddttilgwmiq
tedteyslp

Sequence, based on observed residues (ATOM records):

>d2io7b2 d.3.1.15 (B:12-200) Glutathionylspermidine synthase, amidase domain {Escherichia coli [TaxId: 562]}
fgtllgyapggvaiysavfrsyiddeymghkwqcvefarrflflnygvvftdvgmaweif
slrflrevvndnilplqafpngsprapvagalliwdkggefkdtghvaiitqlhgnkvri
aeqnvihsplpqgqqwtrelemvvengcytlkdtfddttilgwmiqtedteyslp

Timeline for d2io7b2:

• d2io7b2 first appeared in SCOP 1.73
  
• d2io7b2 appears in SCOPe 2.07