Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.15: CHAP domain [142870] (1 protein) Pfam PF05257 |
Protein Glutathionylspermidine synthase, amidase domain [142871] (1 species) |
Species Escherichia coli [TaxId:562] [142872] (5 PDB entries) Uniprot P0AES0 10-200 |
Domain d2io7a2: 2io7 A:10-200 [137544] Other proteins in same PDB: d2io7a1, d2io7a3, d2io7b1, d2io7b3 complexed with anp, mg |
PDB Entry: 2io7 (more details), 2.7 Å
SCOPe Domain Sequences for d2io7a2:
Sequence, based on SEQRES records: (download)
>d2io7a2 d.3.1.15 (A:10-200) Glutathionylspermidine synthase, amidase domain {Escherichia coli [TaxId: 562]} apfgtllgyapggvaiyssdyssldpqeyeddavfrsyiddeymghkwqcvefarrflfl nygvvftdvgmaweifslrflrevvndnilplqafpngsprapvagalliwdkggefkdt ghvaiitqlhgnkvriaeqnvihsplpqgqqwtrelemvvengcytlkdtfddttilgwm iqtedteyslp
>d2io7a2 d.3.1.15 (A:10-200) Glutathionylspermidine synthase, amidase domain {Escherichia coli [TaxId: 562]} apfgtllgyapggvaiyssdyrsyiddeymghkwqcvefarrflflnygvvftdvgmawe ifslrflrevvndnilplqafpngsprapvagalliwdkggefkdtghvaiitqlhgnkv riaeqnvihsplpqgqqwtrelemvvengcytlkdtfddttilgwmiqtedteyslp
Timeline for d2io7a2: