SCOPe 2.07: Domain d2io5c_: 2io5 C:

Lineage for d2io5c_ (2io5 C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (7 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (67 PDB entries)

8. Domain d2io5c_: 2io5 C: [137542]
   Other proteins in same PDB: d2io5a1, d2io5b_
   automated match to d1kx5b_

Details for d2io5c_

PDB Entry: 2io5, 2.7 Å

PDB Description: Crystal structure of the CIA- histone H3-H4 complex

PDB Compounds: (C:) histone h4

SCOPe Domain Sequences for d2io5c_:

Sequence; same for both SEQRES and ATOM records:

>d2io5c_ a.22.1.1 (C:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygf

Timeline for d2io5c_:

• d2io5c_ first appeared in SCOP 1.73, called d2io5c1
  
• d2io5c_ appears in SCOPe 2.06
  
• d2io5c_ appears in the current release, SCOPe 2.08