Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Transducin (alpha subunit) [52623] (4 species) common fold is interrupted with an all-alpha domain |
Species Human (Homo sapiens) [TaxId:9606] [159560] (9 PDB entries) |
Domain d2ik8a2: 2ik8 A:32-60,A:182-348 [137485] Other proteins in same PDB: d2ik8a1, d2ik8b1, d2ik8c1, d2ik8d_ automatically matched to d1kjya2 complexed with alf, gdp, mg, so4 |
PDB Entry: 2ik8 (more details), 2.71 Å
SCOPe Domain Sequences for d2ik8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ik8a2 c.37.1.8 (A:32-60,A:182-348) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} revkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkw ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtkn vqfvfdavtdviiknnl
Timeline for d2ik8a2:
View in 3D Domains from other chains: (mouse over for more information) d2ik8b1, d2ik8c1, d2ik8c2, d2ik8d_ |