SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2ik4b_ (2ik4 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2052342Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2052343Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 protein domains)
    barrel, closed; n=5, S=8
  6. 2052344Protein Inorganic pyrophosphatase [50326] (7 species)
    eukaryotic enzyme has additional secondary structures at both N- and C-termini
  7. 2052345Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50327] (19 PDB entries)
  8. 2052357Domain d2ik4b_: 2ik4 B: [137483]
    automated match to d1e6aa_
    complexed with mg, po4

Details for d2ik4b_

PDB Entry: 2ik4 (more details), 1.8 Å

PDB Description: Yeast inorganic pyrophosphatase variant D117E with magnesium and phosphate
PDB Compounds: (B:) inorganic pyrophosphatase

SCOPe Domain Sequences for d2ik4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ik4b_ b.40.5.1 (B:) Inorganic pyrophosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdnepid
vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
dltnvtlpdtptyskaasdaippaslkadapidksidkwffisg

SCOPe Domain Coordinates for d2ik4b_:

Click to download the PDB-style file with coordinates for d2ik4b_.
(The format of our PDB-style files is described here.)

Timeline for d2ik4b_: