Lineage for d2ik4b1 (2ik4 B:1-282)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668738Superfamily b.40.5: Inorganic pyrophosphatase [50324] (1 family) (S)
  5. 668739Family b.40.5.1: Inorganic pyrophosphatase [50325] (1 protein)
    barrel, closed; n=5, S=8
  6. 668740Protein Inorganic pyrophosphatase [50326] (6 species)
    eukaryotic enzyme has additional secondary structures at both N- and C-termini
  7. 668752Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50327] (13 PDB entries)
  8. 668758Domain d2ik4b1: 2ik4 B:1-282 [137483]
    automatically matched to d117ea_
    complexed with mg, po4; mutant

Details for d2ik4b1

PDB Entry: 2ik4 (more details), 1.8 Å

PDB Description: Yeast inorganic pyrophosphatase variant D117E with magnesium and phosphate
PDB Compounds: (B:) inorganic pyrophosphatase

SCOP Domain Sequences for d2ik4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ik4b1 b.40.5.1 (B:1-282) Inorganic pyrophosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdnepid
vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
dltnvtlpdtptyskaasdaippaslkadapidksidkwffi

SCOP Domain Coordinates for d2ik4b1:

Click to download the PDB-style file with coordinates for d2ik4b1.
(The format of our PDB-style files is described here.)

Timeline for d2ik4b1: