SCOPe 2.01: Domain d2igca_: 2igc A:

Lineage for d2igca_ (2igc A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (3 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (520 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d2igca_: 2igc A: [137368]
   automated match to d2igca1
   complexed with mtn; mutant

Details for d2igca_

PDB Entry: 2igc, 1.4 Å

PDB Description: structure of spin labeled t4 lysozyme mutant t115r1a

PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d2igca_:

Sequence; same for both SEQRES and ATOM records:

>d2igca_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagfcnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

Timeline for d2igca_:

• d2igca_ first appeared in SCOP 1.73, called d2igca1
  
• d2igca_ was called d2igca1 in SCOP 1.75
  
• d2igca_ appears in SCOPe 2.02
  
• d2igca_ appears in the current release, SCOPe 2.08