SCOP 1.73: Domain d2ig9d1: 2ig9 D:4-147

Lineage for d2ig9d1 (2ig9 D:4-147)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (10 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)

7. Species Brevibacterium fuscum [TaxId:47914] [89888] (5 PDB entries)

8. Domain d2ig9d1: 2ig9 D:4-147 [137358]
   automatically matched to d1f1xa1
   complexed with ca, cl, fe2, gol

Details for d2ig9d1

PDB Entry: 2ig9, 1.9 Å

PDB Description: Structure of a full-length Homoprotocatechuate 2,3-Dioxygenase from B. fuscum in a new spacegroup.

PDB Compounds: (D:) homoprotocatechuate 2,3-dioxygenase

SCOP Domain Sequences for d2ig9d1:

Sequence; same for both SEQRES and ATOM records:

>d2ig9d1 d.32.1.3 (D:4-147) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]}
eipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihhn
lvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedplg
fpyefffetthverlhmrydlysa

Timeline for d2ig9d1:

• d2ig9d1 is new in SCOP 1.73
  
• d2ig9d1 appears in SCOP 1.75
  
• d2ig9d1 appears in the current release, SCOPe 2.08