![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (15 families) ![]() |
![]() | Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (3 proteins) |
![]() | Protein UDP-glucose pyrophosphorylase 2 (UDPGP 2) [142686] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142687] (4 PDB entries) |
![]() | Domain d2icyb2: 2icy B:7-383 [137260] Other proteins in same PDB: d2icya1, d2icyb1 automatically matched to 1Z90 A:6-383 complexed with dms, u5p, upg |
PDB Entry: 2icy (more details), 1.64 Å
SCOP Domain Sequences for d2icyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2icyb2 c.68.1.5 (B:7-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} nlpqlksavdgltemseseksgfislvsrylsgeaqhiewskiqtptdeivvpyekmtpv sqdvaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqienlnnkyg ckvplvlmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskgktdkeg wyppghgdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnkneycme vtpktladvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaikk lveadalkmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvkassdll lvqsdlytlvdgfvtrn
Timeline for d2icyb2: