SCOP 1.73: Domain d2icya1: 2icy A:384-466

Lineage for d2icya1 (2icy A:384-466)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (3 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (7 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.4: GlmU C-terminal domain-like [51171] (3 proteins)
   this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain

6. Protein UDP-glucose pyrophosphorylase 2 (UDPGP 2) [141581] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141582] (4 PDB entries)

8. Domain d2icya1: 2icy A:384-466 [137257]
   Other proteins in same PDB: d2icya2, d2icyb2
   automatically matched to 1Z90 A:384-469
   complexed with dms, u5p, upg

Details for d2icya1

PDB Entry: 2icy, 1.64 Å

PDB Description: Crystal Structure of a Putative UDP-glucose Pyrophosphorylase from Arabidopsis Thaliana with Bound UDP-glucose

PDB Compounds: (A:) Probable UTP-glucose-1-phosphate uridylyltransferase 2

SCOP Domain Sequences for d2icya1:

Sequence; same for both SEQRES and ATOM records:

>d2icya1 b.81.1.4 (A:384-466) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kartnpsnpsielgpefkkvatflsrfksipsiveldslkvsgdvwfgssivlkgkvtva
aksgvkleipdravvenkningp

Timeline for d2icya1:

• d2icya1 is new in SCOP 1.73
  
• d2icya1 appears in SCOP 1.75
  
• d2icya1 appears in the current release, SCOPe 2.08