SCOPe 2.07: Domain d2icyb1: 2icy B:384-469

Lineage for d2icyb1 (2icy B:384-469)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins)
   this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain

6. Protein UDP-glucose pyrophosphorylase 2 (UDPGP 2) [141581] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141582] (4 PDB entries)
   Uniprot Q9M9P3 384-469

8. Domain d2icyb1: 2icy B:384-469 [137259]
   Other proteins in same PDB: d2icya2, d2icyb2
   automated match to d2icyb1
   complexed with dms, upg

Details for d2icyb1

PDB Entry: 2icy, 1.64 Å

PDB Description: Crystal Structure of a Putative UDP-glucose Pyrophosphorylase from Arabidopsis Thaliana with Bound UDP-glucose

PDB Compounds: (B:) Probable UTP-glucose-1-phosphate uridylyltransferase 2

SCOPe Domain Sequences for d2icyb1:

Sequence; same for both SEQRES and ATOM records:

>d2icyb1 b.81.1.4 (B:384-469) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kartnpsnpsielgpefkkvatflsrfksipsiveldslkvsgdvwfgssivlkgkvtva
aksgvkleipdravvenkningpedl

Timeline for d2icyb1:

• d2icyb1 first appeared in SCOP 1.73
  
• d2icyb1 appears in SCOPe 2.06
  
• d2icyb1 appears in the current release, SCOPe 2.08