Lineage for d2icsa1 (2ics A:4-54,A:322-371)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819141Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2819142Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2819333Family b.92.1.8: Adenine deaminase [141689] (1 protein)
  6. 2819334Protein Putative adenine deaminase EF0837 [141690] (1 species)
  7. 2819335Species Enterococcus faecalis [TaxId:1351] [141691] (1 PDB entry)
    Uniprot Q837K0 2-52,320-369
  8. 2819336Domain d2icsa1: 2ics A:4-54,A:322-371 [137241]
    Other proteins in same PDB: d2icsa2
    complexed with ade, zn

Details for d2icsa1

PDB Entry: 2ics (more details), 2.3 Å

PDB Description: crystal structure of an adenine deaminase
PDB Compounds: (A:) Adenine Deaminase

SCOPe Domain Sequences for d2icsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2icsa1 b.92.1.8 (A:4-54,A:322-371) Putative adenine deaminase EF0837 {Enterococcus faecalis [TaxId: 1351]}
dydllikngqtvngmpveiaikekkiaavaatisgsaketihlepgtyvsaXtleigkda
dltiftiqaeektltdsngltrvakeqirpiktiiggqiydn

SCOPe Domain Coordinates for d2icsa1:

Click to download the PDB-style file with coordinates for d2icsa1.
(The format of our PDB-style files is described here.)

Timeline for d2icsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2icsa2