![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
![]() | Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
![]() | Family b.92.1.8: Adenine deaminase [141689] (1 protein) |
![]() | Protein Putative adenine deaminase EF0837 [141690] (1 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [141691] (1 PDB entry) Uniprot Q837K0 2-52,320-369 |
![]() | Domain d2icsa1: 2ics A:4-54,A:322-371 [137241] Other proteins in same PDB: d2icsa2 complexed with ade, zn |
PDB Entry: 2ics (more details), 2.3 Å
SCOPe Domain Sequences for d2icsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2icsa1 b.92.1.8 (A:4-54,A:322-371) Putative adenine deaminase EF0837 {Enterococcus faecalis [TaxId: 1351]} dydllikngqtvngmpveiaikekkiaavaatisgsaketihlepgtyvsaXtleigkda dltiftiqaeektltdsngltrvakeqirpiktiiggqiydn
Timeline for d2icsa1: