Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Hedgehog receptor iHog [141061] (1 species) Cg9211-PA |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [141062] (3 PDB entries) Uniprot Q9VM64 466-572! Uniprot Q9VM64 573-667 |
Domain d2ic2b2: 2ic2 B:466-577 [137234] Other proteins in same PDB: d2ic2a2, d2ic2b3 automated match to d2ic2a1 complexed with so4 |
PDB Entry: 2ic2 (more details), 1.3 Å
SCOPe Domain Sequences for d2ic2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ic2b2 b.1.2.1 (B:466-577) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} ypptppnvtrlsdesvmlrwmvprndglpivifkvqyrmvgkrknwqttndnipygkpkw nselgksftasvtdlkpqhtyrfrilavysnndnkesntsakfylqpgaald
Timeline for d2ic2b2: