SCOPe 2.02: Domain d2ibtd1: 2ibt D:21-243

Lineage for d2ibtd1 (2ibt D:21-243)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.27: DNA methylase TaqI, N-terminal domain [88787] (1 protein)

6. Protein DNA methylase TaqI, N-terminal domain [53369] (1 species)

7. Species Thermus aquaticus [TaxId:271] [53370] (12 PDB entries)

8. Domain d2ibtd1: 2ibt D:21-243 [137207]
   Other proteins in same PDB: d2ibta2, d2ibtd2
   automatically matched to d1aqia1
   protein/DNA complex; complexed with gol, nea

Details for d2ibtd1

PDB Entry: 2ibt, 1.7 Å

PDB Description: crystal structure of the adenine-specific dna methyltransferase m.taqi complexed with the cofactor analog aeta and a 10 bp dna containing 2- aminopurine at the target position and an abasic site analog at the target base partner position

PDB Compounds: (D:) modification methylase taqi

SCOPe Domain Sequences for d2ibtd1:

Sequence; same for both SEQRES and ATOM records:

>d2ibtd1 c.66.1.27 (D:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]}
vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtayrfvgveidpkaldlp
pwaegiladfllwepgeafdlilgnppygivgeaskypihvfkavkdlykkafstwkgky
nlygaflekavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkk
vsavvirfqksgkglslwdtqesesgftpilwaeyphwegeii

Timeline for d2ibtd1:

• d2ibtd1 first appeared in SCOP 1.73
  
• d2ibtd1 appears in SCOPe 2.01
  
• d2ibtd1 appears in SCOPe 2.03
  
• d2ibtd1 appears in the current release, SCOPe 2.08