Lineage for d2i9bc2 (2i9b C:50-132)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1461545Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 1461546Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 1461547Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 1461628Protein Urokinase-type plasminogen activator [57453] (1 species)
  7. 1461629Species Human (Homo sapiens) [TaxId:9606] [57454] (7 PDB entries)
  8. 1461638Domain d2i9bc2: 2i9b C:50-132 [137123]
    Other proteins in same PDB: d2i9ba1, d2i9bb1, d2i9bc1, d2i9bd1, d2i9be1, d2i9be2, d2i9be3, d2i9bf1, d2i9bf2, d2i9bf3, d2i9bg1, d2i9bg2, d2i9bg3, d2i9bh1, d2i9bh2, d2i9bh3
    automatically matched to d1urk_2
    complexed with so4

Details for d2i9bc2

PDB Entry: 2i9b (more details), 2.8 Å

PDB Description: crystal structure of atf-urokinase receptor complex
PDB Compounds: (C:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d2i9bc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i9bc2 g.14.1.1 (C:50-132) Urokinase-type plasminogen activator {Human (Homo sapiens) [TaxId: 9606]}
cyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrr
rpwcyvqvglkplvqecmvhdca

SCOPe Domain Coordinates for d2i9bc2:

Click to download the PDB-style file with coordinates for d2i9bc2.
(The format of our PDB-style files is described here.)

Timeline for d2i9bc2: