SCOP 1.73: Domain d2i9bc2: 2i9b C:50-132

Lineage for d2i9bc2 (2i9b C:50-132)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (2 families)

5. Family g.14.1.1: Kringle modules [57441] (6 proteins)

6. Protein Urokinase-type plasminogen activator [57453] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57454] (5 PDB entries)

8. Domain d2i9bc2: 2i9b C:50-132 [137123]
   Other proteins in same PDB: d2i9ba1, d2i9bb1, d2i9bc1, d2i9bd1
   automatically matched to d1urk_2
   complexed with bma, nag, so4; mutant

Details for d2i9bc2

PDB Entry: 2i9b, 2.8 Å

PDB Description: crystal structure of atf-urokinase receptor complex

PDB Compounds: (C:) urokinase-type plasminogen activator

SCOP Domain Sequences for d2i9bc2:

Sequence; same for both SEQRES and ATOM records:

>d2i9bc2 g.14.1.1 (C:50-132) Urokinase-type plasminogen activator {Human (Homo sapiens) [TaxId: 9606]}
cyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrr
rpwcyvqvglkplvqecmvhdca

Timeline for d2i9bc2:

• d2i9bc2 is new in SCOP 1.73
  
• d2i9bc2 appears in SCOP 1.75
  
• d2i9bc2 appears in the current release, SCOPe 2.08