Lineage for d2hzbd1 (2hzb D:2-312)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 849589Fold c.143: CofD-like [142337] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567; topological similarity to the CobT-like fold ((52732))
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567; topological similarity to the CobT-like fold ((52732))
  4. 849590Superfamily c.143.1: CofD-like [142338] (1 family) (S)
  5. 849591Family c.143.1.1: CofD-like [142339] (2 proteins)
    Pfam PF01933; UPF0052
  6. 849592Protein Hypothetical protein BH3568 [142342] (1 species)
  7. 849593Species Bacillus halodurans [TaxId:86665] [142343] (1 PDB entry)
    Uniprot Q9K706 2-312
  8. 849597Domain d2hzbd1: 2hzb D:2-312 [136914]
    automatically matched to 2HZB A:2-312

Details for d2hzbd1

PDB Entry: 2hzb (more details), 2.8 Å

PDB Description: x-ray crystal structure of protein bh3568 from bacillus halodurans. northeast structural genomics consortium bhr60.
PDB Compounds: (D:) Hypothetical UPF0052 protein BH3568

SCOP Domain Sequences for d2hzbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hzbd1 c.143.1.1 (D:2-312) Hypothetical protein BH3568 {Bacillus halodurans [TaxId: 86665]}
kkknvvvfgggtglsvllrglktfpvsitaivtvaddggssgrlrkeldipppgdvrnvl
valseveplleqlfqhrfengnglsghslgnlllagmtsitgdfargisemskvlnvrgk
vlpasnrsiilhgemedgtivtgessipkagkkikrvfltpkdtkplregleairkadvi
vigpgslytsvlpnllvpgiceaikqstarkvyicnvmtqngetdgytasdhlqaimdhc
gvgivddilvhgepisdtvkakyakekaepvivdehklkalgvgtisdyfvleqddvlrh
naskvseaile

SCOP Domain Coordinates for d2hzbd1:

Click to download the PDB-style file with coordinates for d2hzbd1.
(The format of our PDB-style files is described here.)

Timeline for d2hzbd1: