SCOP 1.73: Domain d2hzbd1: 2hzb D:2-312

Lineage for d2hzbd1 (2hzb D:2-312)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.143: CofD-like [142337] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567; topological similarity to the CobT-like fold (scop_cf 52732)

4. Superfamily c.143.1: CofD-like [142338] (1 family)

5. Family c.143.1.1: CofD-like [142339] (2 proteins)
   Pfam PF01933; UPF0052

6. Protein Hypothetical protein BH3568 [142342] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [142343] (1 PDB entry)

8. Domain d2hzbd1: 2hzb D:2-312 [136914]
   automatically matched to 2HZB A:2-312

Details for d2hzbd1

PDB Entry: 2hzb, 2.8 Å

PDB Description: x-ray crystal structure of protein bh3568 from bacillus halodurans. northeast structural genomics consortium bhr60.

PDB Compounds: (D:) Hypothetical UPF0052 protein BH3568

SCOP Domain Sequences for d2hzbd1:

Sequence; same for both SEQRES and ATOM records:

>d2hzbd1 c.143.1.1 (D:2-312) Hypothetical protein BH3568 {Bacillus halodurans [TaxId: 86665]}
kkknvvvfgggtglsvllrglktfpvsitaivtvaddggssgrlrkeldipppgdvrnvl
valseveplleqlfqhrfengnglsghslgnlllagmtsitgdfargisemskvlnvrgk
vlpasnrsiilhgemedgtivtgessipkagkkikrvfltpkdtkplregleairkadvi
vigpgslytsvlpnllvpgiceaikqstarkvyicnvmtqngetdgytasdhlqaimdhc
gvgivddilvhgepisdtvkakyakekaepvivdehklkalgvgtisdyfvleqddvlrh
naskvseaile

Timeline for d2hzbd1:

• d2hzbd1 is new in SCOP 1.73
  
• d2hzbd1 appears in SCOP 1.75
  
• d2hzbd1 appears in the current release, SCOPe 2.08, called d2hzbd_