Lineage for d2hyig_ (2hyi G:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1230170Fold d.232: Mago nashi protein [89816] (1 superfamily)
    beta(4)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, order: 651234
  4. 1230171Superfamily d.232.1: Mago nashi protein [89817] (1 family) (S)
  5. 1230172Family d.232.1.1: Mago nashi protein [89818] (1 protein)
  6. 1230173Protein Mago nashi protein [89819] (2 species)
  7. 1230179Species Human (Homo sapiens) [TaxId:9606] [102750] (5 PDB entries)
  8. 1230184Domain d2hyig_: 2hyi G: [136894]
    Other proteins in same PDB: d2hyib_, d2hyic1, d2hyic2, d2hyih_, d2hyii1, d2hyii2
    automated match to d1p27a_
    protein/RNA complex; complexed with anp, mg

Details for d2hyig_

PDB Entry: 2hyi (more details), 2.3 Å

PDB Description: Structure of the human exon junction complex with a trapped DEAD-box helicase bound to RNA
PDB Compounds: (G:) Protein mago nashi homolog

SCOPe Domain Sequences for d2hyig_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyig_ d.232.1.1 (G:) Mago nashi protein {Human (Homo sapiens) [TaxId: 9606]}
sdfylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeelkr
iiddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglrvf
yylvqdlkclvfsliglhfkikpi

SCOPe Domain Coordinates for d2hyig_:

Click to download the PDB-style file with coordinates for d2hyig_.
(The format of our PDB-style files is described here.)

Timeline for d2hyig_: