Lineage for d2hygd1 (2hyg D:3-62)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1079364Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1079858Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins)
  6. 1079916Protein Manganese transport regulator MntR [88986] (1 species)
  7. 1079917Species Bacillus subtilis [TaxId:1423] [88987] (11 PDB entries)
  8. 1079939Domain d2hygd1: 2hyg D:3-62 [136888]
    Other proteins in same PDB: d2hygd2
    automatically matched to d1on1a1

Details for d2hygd1

PDB Entry: 2hyg (more details), 2.8 Å

PDB Description: The Structure of apo-MntR from Bacillus subtilis, Native Form
PDB Compounds: (D:) Transcriptional regulator mntR

SCOPe Domain Sequences for d2hygd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hygd1 a.4.5.24 (D:3-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
tpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl

SCOPe Domain Coordinates for d2hygd1:

Click to download the PDB-style file with coordinates for d2hygd1.
(The format of our PDB-style files is described here.)

Timeline for d2hygd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hygd2