SCOPe 2.06: Domain d2hyfa1: 2hyf A:3-62

Lineage for d2hyfa1 (2hyf A:3-62)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
   automatically mapped to Pfam PF01325

6. Protein Manganese transport regulator MntR [88986] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [88987] (11 PDB entries)

8. Domain d2hyfa1: 2hyf A:3-62 [136880]
   Other proteins in same PDB: d2hyfa2, d2hyfb2, d2hyfc2, d2hyfd2
   automated match to d1on1a1
   complexed with epe, so4

Details for d2hyfa1

PDB Entry: 2hyf, 2.8 Å

PDB Description: The Structure of apo-MntR from Bacillus subtilis, selenomethionine derivative

PDB Compounds: (A:) Transcriptional regulator mntR

SCOPe Domain Sequences for d2hyfa1:

Sequence; same for both SEQRES and ATOM records:

>d2hyfa1 a.4.5.24 (A:3-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
tpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl

Timeline for d2hyfa1:

• d2hyfa1 first appeared in SCOP 1.73
  
• d2hyfa1 appears in SCOPe 2.05
  
• d2hyfa1 appears in SCOPe 2.07
  
• d2hyfa1 appears in the current release, SCOPe 2.08