SCOPe 2.03: Domain d2hxma_: 2hxm A:

Lineage for d2hxma_ (2hxm A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)

6. Protein Uracil-DNA glycosylase [52143] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52144] (14 PDB entries)

8. Domain d2hxma_: 2hxm A: [136857]
   automated match to d1akz__
   protein/DNA complex; complexed with 302

Details for d2hxma_

PDB Entry: 2hxm, 1.3 Å

PDB Description: Complex of UNG2 and a small Molecule synthetic Inhibitor

PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d2hxma_:

Sequence; same for both SEQRES and ATOM records:

>d2hxma_ c.18.1.1 (A:) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

Timeline for d2hxma_:

• d2hxma_ first appeared in SCOP 1.73, called d2hxma1
  
• d2hxma_ appears in SCOPe 2.02
  
• d2hxma_ appears in SCOPe 2.04
  
• d2hxma_ appears in the current release, SCOPe 2.08, called d2hxma2