SCOP 1.73: Domain d2hxma1: 2hxm A:82-304

Lineage for d2hxma1 (2hxm A:82-304)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (3 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)

6. Protein Uracil-DNA glycosylase [52143] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52144] (9 PDB entries)

8. Domain d2hxma1: 2hxm A:82-304 [136857]
   automatically matched to d1akz__
   complexed with 302

Details for d2hxma1

PDB Entry: 2hxm, 1.3 Å

PDB Description: Complex of UNG2 and a small Molecule synthetic Inhibitor

PDB Compounds: (A:) uracil-DNA glycosylase

SCOP Domain Sequences for d2hxma1:

Sequence; same for both SEQRES and ATOM records:

>d2hxma1 c.18.1.1 (A:82-304) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

Timeline for d2hxma1:

• d2hxma1 is new in SCOP 1.73
  
• d2hxma1 appears in SCOP 1.75
  
• d2hxma1 appears in the current release, SCOPe 2.08, called d2hxma2