Lineage for d2hxma1 (2hxm A:82-304)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691382Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 691383Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (3 families) (S)
  5. 691384Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)
  6. 691385Protein Uracil-DNA glycosylase [52143] (4 species)
  7. 691417Species Human (Homo sapiens) [TaxId:9606] [52144] (9 PDB entries)
  8. 691418Domain d2hxma1: 2hxm A:82-304 [136857]
    automatically matched to d1akz__
    complexed with 302

Details for d2hxma1

PDB Entry: 2hxm (more details), 1.3 Å

PDB Description: Complex of UNG2 and a small Molecule synthetic Inhibitor
PDB Compounds: (A:) uracil-DNA glycosylase

SCOP Domain Sequences for d2hxma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hxma1 c.18.1.1 (A:82-304) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

SCOP Domain Coordinates for d2hxma1:

Click to download the PDB-style file with coordinates for d2hxma1.
(The format of our PDB-style files is described here.)

Timeline for d2hxma1: