SCOPe 2.05: Domain d2hxgb2: 2hxg B:1-328

Lineage for d2hxgb2 (2hxg B:1-328)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.85: FucI/AraA N-terminal and middle domains [53742] (1 superfamily)
   consists of two domains of similar topology, 3 layers (a/b/a) each
   Domain 1 (1-173) has parallel beta-sheet of 5 strands, order 21345
   Domain 2 (174-355) has parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.85.1: FucI/AraA N-terminal and middle domains [53743] (3 families)

5. Family c.85.1.2: AraA N-terminal and middle domain-like [142760] (2 proteins)
   N-terminal part of Pfam PF02610

6. Protein L-arabinose isomerase AraA [142761] (1 species)

7. Species Escherichia coli [TaxId:562] [142762] (2 PDB entries)
   Uniprot P08202 1-328

8. Domain d2hxgb2: 2hxg B:1-328 [136846]
   Other proteins in same PDB: d2hxga1, d2hxgb1, d2hxgc1
   automated match to d2ajta2
   complexed with mn

Details for d2hxgb2

PDB Entry: 2hxg, 2.8 Å

PDB Description: crystal structure of mn2+ bound ecai

PDB Compounds: (B:) L-arabinose isomerase

SCOPe Domain Sequences for d2hxgb2:

Sequence; same for both SEQRES and ATOM records:

>d2hxgb2 c.85.1.2 (B:1-328) L-arabinose isomerase AraA {Escherichia coli [TaxId: 562]}
mtifdnyevwfvigsqhlygpetlrqvtqhaehvvnalnteaklpcklvlkplgttpdei
taicrdanyddpcaglvvwlhtfspakmwingltmlnkpllqfhtqfnaalpwdsidmdf
mnlnqtahggrefgfigarmrqqhavvtghwqdkqaherigswmrqavskqdtrhlkvcr
fgdnmrevavtdgdkvaaqikfgfsvntwavgdlvqvvnsisdgdvnalvdeyescytmt
patqihgekrqnvleaarielgmkrfleqggfhaftttfedlhglkqlpglavqrlmqqg
ygfagegdwktaallrimkvmstglqgg

Timeline for d2hxgb2:

• d2hxgb2 first appeared in SCOP 1.73
  
• d2hxgb2 appears in SCOPe 2.04
  
• d2hxgb2 appears in SCOPe 2.06
  
• d2hxgb2 appears in the current release, SCOPe 2.08