![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.85: FucI/AraA N-terminal and middle domains [53742] (1 superfamily) consists of two domains of similar topology, 3 layers (a/b/a) each Domain 1 (1-173) has parallel beta-sheet of 5 strands, order 21345 Domain 2 (174-355) has parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.85.1: FucI/AraA N-terminal and middle domains [53743] (3 families) ![]() |
![]() | Family c.85.1.2: AraA N-terminal and middle domain-like [142760] (2 proteins) N-terminal part of Pfam PF02610 |
![]() | Protein L-arabinose isomerase AraA [142761] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [142762] (2 PDB entries) Uniprot P08202 1-328 |
![]() | Domain d2hxgb2: 2hxg B:1-328 [136846] Other proteins in same PDB: d2hxga1, d2hxgb1, d2hxgc1 automated match to d2ajta2 complexed with mn |
PDB Entry: 2hxg (more details), 2.8 Å
SCOPe Domain Sequences for d2hxgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hxgb2 c.85.1.2 (B:1-328) L-arabinose isomerase AraA {Escherichia coli [TaxId: 562]} mtifdnyevwfvigsqhlygpetlrqvtqhaehvvnalnteaklpcklvlkplgttpdei taicrdanyddpcaglvvwlhtfspakmwingltmlnkpllqfhtqfnaalpwdsidmdf mnlnqtahggrefgfigarmrqqhavvtghwqdkqaherigswmrqavskqdtrhlkvcr fgdnmrevavtdgdkvaaqikfgfsvntwavgdlvqvvnsisdgdvnalvdeyescytmt patqihgekrqnvleaarielgmkrfleqggfhaftttfedlhglkqlpglavqrlmqqg ygfagegdwktaallrimkvmstglqgg
Timeline for d2hxgb2:
![]() Domains from other chains: (mouse over for more information) d2hxga1, d2hxga2, d2hxgc1, d2hxgc2 |